PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00101.1.g00220.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 643aa    MW: 67990.6 Da    PI: 9.8514
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00101.1.g00220.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof111.83.1e-35223283262
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                   ++ al+cprCd+tntkfCyynny++ qPry+CkaC+ryWt+GG+ rn+PvGg++rk++k+s
  Zjn_sc00101.1.g00220.1.am.mk 223 PDVALPCPRCDATNTKFCYYNNYNMLQPRYLCKACKRYWTHGGSQRNIPVGGASRKQNKRS 283
                                   567899**************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-21221282IPR003851Zinc finger, Dof-type
PfamPF027016.2E-30226281IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.251227281IPR003851Zinc finger, Dof-type
PROSITE patternPS013610229265IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 643 aa     Download sequence    Send to blast
MIWSWTHPDA DTRRPVPSHH PHAVPPFHVY GSAAVTLGIQ MPLRSLNIGG REQHKHQRNN  60
TARLLVEQAV GMLPPGCTVD ALQGARGACV RQPCRASCLH GNSVSISISS CMHRVLADVI  120
CTPIMPGDMW GPFYPLPPHR PRSPLPDFLV VLSPHHVQYK TEGNLFCGSE EKMTNSKKSN  180
TSAGASSAHS NNIQQEARNM RQARAARQQV AANAGERRPR PQPDVALPCP RCDATNTKFC  240
YYNNYNMLQP RYLCKACKRY WTHGGSQRNI PVGGASRKQN KRSSASLSLP AAASSSSVIN  300
KELQQQLLPA APMIEPAADF NVFPSFMSTG FEHHSNQLPF SPAPGPLPLP TLLPPAPVLA  360
PDAGTPSFLD MLRGGFLDYQ TNGFYAPATP STGMEAPPPL PFGGAAQPGV AGGRQGGGAA  420
PTGGHVDATA AGQGAAWPKP QGRTLSQPFL SPSRHIVAVR ASFFSTPPPS PLSAPDPTPP  480
RTATAQTSPS AVSLPSARHS LCSLSPTCVL YRTSAARCRA HPSPPPNPSP GLCTTPPLAS  540
LVVPYARGRG VHSALLVPVV SSLPRQSVNR IGCGIDGSGF ERQLGTVVAA CSGRGVARLS  600
LLACTPVHTR ALPALHPHSC ARLSSYQLVA SVEAGGCCFA HVI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1411417GGRQGGG
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2247437
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.13e-29Dof family protein